PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Kalax.0426s0029.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Saxifragales; Crassulaceae; Kalanchoe
Family G2-like
Protein Properties Length: 421aa    MW: 44972.6 Da    PI: 7.1629
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Kalax.0426s0029.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like76.92.6e-24160213156
              G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRla 56 
                          k +++WtpeLH+rFv+aveqLG  ekA+P++ile+m+ +gLt+++++S LQkYR++
  Kalax.0426s0029.1.p 160 KVKVDWTPELHKRFVQAVEQLG--EKAVPSRILEIMGADGLTRHNIASQLQKYRSH 213
                          5689*****************4..88****************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129415.29157215IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.4E-23158216IPR009057Homeodomain-like
SuperFamilySSF466891.38E-13159216IPR009057Homeodomain-like
TIGRFAMsTIGR015572.4E-22160213IPR006447Myb domain, plants
PfamPF002493.5E-9163211IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 421 aa     Download sequence    Send to blast
MLVASSLRDS TSKNNDTEET IVGVEMDDFP GGSLLEYSID FDELFAGLDE DPDALPDLEI  60
LGDYYSVSAG TGDERGQSSN DGNDMVSGSA GSPFGSGSGL DSSVCSPSEG AAVVDQAEEV  120
GAKKDGKEHQ GHFGKVKKLA ASAAKAGRSS KTGGGDGKRK VKVDWTPELH KRFVQAVEQL  180
GEKAVPSRIL EIMGADGLTR HNIASQLQKY RSHRKHLIAR EAEAASWNQR RHLYGGARAG  240
GVGKRAGVSP WLVPTIGFPP PMPQPLHRPL GPLHVWGHPS GGHSQSNTMW PKHIVPHHHL  300
RPPHLQPRPV WAPPHPHHLP YGPSQGMPCY PSPPQRFVAP PVPGIPHHAV YKNDPRAAAG  360
QPPRLHPPLD STPSNDTIDA ALEDVLAKPW LPLPIGLKPP AIDTVVGELQ RHGVPQIPPS  420
*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007132777.11e-107hypothetical protein PHAVU_011G124200g
TrEMBLV7AKX51e-107V7AKX5_PHAVU; Uncharacterized protein
STRINGGLYMA12G13430.14e-99(Glycine max)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G20570.11e-51GBF's pro-rich region-interacting factor 1